C4orf3 (NM_001001701) Human Mass Spec Standard
CAT#: PH305103
C4orf3 MS Standard C13 and N15-labeled recombinant protein (NP_001001701)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205103 |
Predicted MW | 7.6 kDa |
Protein Sequence |
>RC205103 protein sequence
Red=Cloning site Green=Tags(s) MEVDAPGVDGRDGLREQRGFSEGGRQNFDVRPQSGANGLPKHSYWLDLWLFILFDVVVFLFVYFLP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001001701 |
RefSeq Size | 2854 |
RefSeq ORF | 198 |
Synonyms | ALN; HCVFTP1 |
Locus ID | 401152 |
UniProt ID | Q8WVX3 |
Cytogenetics | 4q26 |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424211 | C4orf3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424211 | Transient overexpression lysate of chromosome 4 open reading frame 3 (C4orf3), transcript variant 2 |
USD 436.00 |
|
TP305103 | Purified recombinant protein of Homo sapiens chromosome 4 open reading frame 3 (C4orf3), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review