Thymosin beta 10 (TMSB10) (NM_021103) Human Mass Spec Standard

CAT#: PH305097

TMSB10 MS Standard C13 and N15-labeled recombinant protein (NP_066926)

Product Images

Coomassie blue staining of purified TMSB10 protein (Cat# TP305097). The protein was produced from HEK293T cells transfected with TMSB10 cDNA clone (Cat# RC205097) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205097
• Predicted MW: 5 kDa
• Protein Sequence:
  Sequence Link

  >RC205097 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066926
• RefSeq Size: 482
• RefSeq ORF: 132
• Synonyms: MIG12; TB10
• Locus ID: 9168
• UniProt ID: P63313
• Cytogenetics: 2p11.2
• Summary: Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity).[UniProtKB/Swiss-Prot Function]