Viperin (RSAD2) (NM_080657) Human Mass Spec Standard

CAT#: PH305066

RSAD2 MS Standard C13 and N15-labeled recombinant protein (NP_542388)

Product Images

Coomassie blue staining of purified RSAD2 protein (Cat# TP305066). The protein was produced from HEK293T cells transfected with RSAD2 cDNA clone (Cat# RC205066) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205066
• Predicted MW: 42.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205066 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLRATKRRKQQLVLRGPDETKEEEEDPPLPT
  TPTSVNYHFTRQCNYKCGFCFHTAKTSFVLPLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLV
  RFCKVELRLPSVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNHVENLQKLRRW
  CRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQCLLIEGENCGEDALREAERFVIGDEEFERFL
  ERHKEVSCLVPESNQKMKDSYLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY
  IWSKADLKLDW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_542388
• RefSeq Size: 3512
• RefSeq ORF: 1083
• Synonyms: cig5; cig33; vig1
• Locus ID: 91543
• UniProt ID: Q8WXG1
• Cytogenetics: 2p25.2
• Summary: The protein encoded by this gene is an interferon-inducible antiviral protein that belongs to the S-adenosyl-L-methionine (SAM) superfamily of enzymes. The protein plays a role in cellular antiviral response and innate immune signaling. Antiviral effects result from inhibition of viral RNA replication, interference in the secretory pathway, binding to viral proteins and dysregulation of cellular lipid metabolism. The protein has been found to inhibit both DNA and RNA viruses, including influenza virus, human immunodeficiency virus (HIV-1) and Zika virus. [provided by RefSeq, Sep 2020]