BRDG 1 (STAP1) (NM_012108) Human Mass Spec Standard
CAT#: PH304854
STAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036240)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204854 |
Predicted MW | 34.3 kDa |
Protein Sequence |
>RC204854 protein sequence
Red=Cloning site Green=Tags(s) MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDKKSIIYVDKLD IVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHE VLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRN YSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPS MEGRSEKLKKNPHIA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_036240 |
RefSeq Size | 1524 |
RefSeq ORF | 885 |
Synonyms | BRDG1; STAP-1 |
Locus ID | 26228 |
UniProt ID | Q9ULZ2, A0A024RD91 |
Cytogenetics | 4q13.2 |
Summary | The protein encoded by this gene contains a proline-rich region, a pleckstrin homology (PH) domain, and a region in the carboxy terminal half with similarity to the Src Homology 2 (SH2) domain. This protein is a substrate of tyrosine-protein kinase Tec, and its interaction with tyrosine-protein kinase Tec is phosphorylation-dependent. This protein is thought to participate in a positive feedback loop by upregulating the activity of tyrosine-protein kinase Tec. Variants of this gene have been associated with autosomal-dominant hypercholesterolemia (ADH), which is characterized by elevated low-density lipoprotein cholesterol levels and in increased risk of coronary vascular disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415977 | STAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415977 | Transient overexpression lysate of signal transducing adaptor family member 1 (STAP1) |
USD 436.00 |
|
TP304854 | Recombinant protein of human signal transducing adaptor family member 1 (STAP1), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review