OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AIPL1 (NM_014336) Human Mass Spec Standard

Be the first to review this product
SKU
PH304079
AIPL1 MS Standard C13 and N15-labeled recombinant protein (NP_055151)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA503693 AIPL1 mouse monoclonal antibody, clone OTI3B4 (formerly 3B4) 100 ul
$447.00
LY415353 Transient overexpression lysate of aryl hydrocarbon receptor interacting protein-like 1 (AIPL1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "AIPL1 or NM_014336"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204079
Predicted MW 43.9 kDa
Protein Sequence
Protein Sequence
>RC204079 protein sequence
Red=Cloning site Green=Tags(s)

MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLE
VWEILLTSMRVHEVAEFWCDTIHTGVYPILSRSLRQMAQGKDPTEWHVHTCGLANMFAYHTLGYEDLDEL
QKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEGNRLFKLGRYEEASSKYQEAIICLRN
LQTKEKPWEVQWLKLEKMINTLILNYCQCLLKKEEYYEVLEHTSDILRHHPGIVKAYYVRARAHAEVWNE
AEAKADLQKVLELEPSMQKAVRRELRLLENRMAEKQEEERLRCRNMLSQGATQPPAEPPTEPPAQSSTEP
PAEPPTAPSAELSAGPPAEPATEPPPSPGHSLQH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055151
RefSeq Size 2990
RefSeq ORF 1152
Synonyms AIPL2; LCA4
Locus ID 23746
UniProt ID Q9NZN9
Cytogenetics 17p13.2
Summary Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are diagnosed at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2014
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "AIPL1" proteins (3)
SKU Description Size Price
LC415353 Lyophilized AIPL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415353 Transient overexpression lysate of aryl hydrocarbon receptor interacting protein-like 1 (AIPL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP304079 Recombinant protein of human aryl hydrocarbon receptor interacting protein-like 1 (AIPL1), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products