ARL11 (NM_138450) Human Mass Spec Standard

CAT#: PH303868

ARL11 MS Standard C13 and N15-labeled recombinant protein (NP_612459)

Product Images

Coomassie blue staining of purified ARL11 protein (Cat# TP303868). The protein was produced from HEK293T cells transfected with ARL11 cDNA clone (Cat# RC203868) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203868
• Predicted MW: 21.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203868 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPL
  RASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLS
  LERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612459
• RefSeq Size: 3760
• RefSeq ORF: 588
• Synonyms: ARLTS1
• Locus ID: 115761
• UniProt ID: Q969Q4
• Cytogenetics: 13q14.2
• Summary: This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010]