EFS (NM_032459) Human Mass Spec Standard
CAT#: PH303800
EFS MS Standard C13 and N15-labeled recombinant protein (NP_115835)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203800 |
Predicted MW | 49 kDa |
Protein Sequence |
>RC203800 protein sequence
Red=Cloning site Green=Tags(s) MAIATSVYVVPPPARPCPTSGPPAGPCPPSPDLIYKIPRASGTQLAAPRDALEVYDVPPTALRVPSSGPY DCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLY EAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALASHDQDTLAQLLARSPPPPHRPRLPSAESLS RRPLPALPVPEAPSPSPVPSPAPGRKGSIQDRPLPPPPPRLPGYGGPKVEGDPEGREMEDDPAGHHNEYE GIPMAEEYDYVHLKGMDKAQGSRPPDQACTGDPELPERGMPAPQEALSPGEPLVVSTGDLQLLYFYAGQC QSHYSALQAAVAALMSSTQANQPPRLFVPHSKRVVVAAHRLVFVGDTLGRLAASAPLRAQVRAAGTALGQ ALRATVLAVKGAALGYPSSPAIQEMVQCVTELAGQALQFTTLLTSLAP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115835 |
RefSeq Size | 2851 |
RefSeq ORF | 1404 |
Synonyms | CAS3; CASS3; EFS1; EFS2; HEFS; SIN |
Locus ID | 10278 |
UniProt ID | O43281 |
Cytogenetics | 14q11.2 |
Summary | The protein encoded by this gene is a member of the CAS (CRK-associated substrate) family of adaptor proteins which typically serve as scaffolds for the assembly of larger signaling complexes. These complexes form at the cell surface where integrin binding leads to the subsequent phosphorylation of a CAS protein. Additional binding of SRC family kinases leads to CAS hyperphosphorylation and the creation of binding sites for CRK and other proteins that cause actin cytoskeleton reorganization. This gene plays a role in integrin-mediated cell attachment, spreading, and migration and also plays a role in both normal and malignant cellular transformation. This broadly expressed gene has been shown to play a role in neurite outgrowth and its expression in the thymus and lymphocytes is important for T cell maturation and the development of immunological self-tolerance. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2020] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410095 | EFS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC417016 | EFS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY410095 | Transient overexpression lysate of embryonal Fyn-associated substrate (EFS), transcript variant 2 |
USD 436.00 |
|
LY417016 | Transient overexpression lysate of embryonal Fyn-associated substrate (EFS), transcript variant 1 |
USD 665.00 |
|
TP303800 | Recombinant protein of human embryonal Fyn-associated substrate (EFS), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review