U1SNRNPBP (SNRNP35) (NM_180699) Human Mass Spec Standard

CAT#: PH303746

SNRNP35 MS Standard C13 and N15-labeled recombinant protein (NP_851030)

Product Images

Coomassie blue staining of purified SNRNP35 protein (Cat# TP303746). The protein was produced from HEK293T cells transfected with SNRNP35 cDNA clone (Cat# RC203746) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203746
• Predicted MW: 30 kDa
• Protein Sequence:
  Sequence Link

  >RC203746 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKPANMNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKED
  KLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGW
  IPRRLGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWDSRTRDRDHDR
  GREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_851030
• RefSeq Size: 1070
• RefSeq ORF: 753
• Synonyms: HM-1; U1SNRNPBP
• Locus ID: 11066
• UniProt ID: Q16560
• Cytogenetics: 12q24.31
• Summary: The protein encoded by this gene is a homolog of the U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, which is a characteristic of a variety of splicing factors. This protein is a component of the U11/U12 small nuclear ribonucleoproteins (snRNP) that form part of the U12-type spliceosome. Alternative splicing results in multiple transcript variants encoding two distinct isoforms and representing a non-protein coding variant. [provided by RefSeq, Aug 2013]