CDC34 (NM_004359) Human Mass Spec Standard
CAT#: PH303517
CDC34 MS Standard C13 and N15-labeled recombinant protein (NP_004350)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203517 |
Predicted MW | 26.6 kDa |
Protein Sequence |
>RC203517 representing NM_004359
Red=Cloning site Green=Tags(s) MARPLVPSSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPY SPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPA NVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDY YEDGEVEEEADSCFGDDEDDSGTEES myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004350 |
RefSeq Size | 1462 |
RefSeq ORF | 708 |
Synonyms | E2-CDC34; UBC3; UBCH3; UBE2R1 |
Locus ID | 997 |
UniProt ID | P49427, A0A024R1Z1 |
Cytogenetics | 19p13.3 |
Summary | The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication. [provided by RefSeq, Jul 2008] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418044 | CDC34 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418044 | Transient overexpression lysate of cell division cycle 34 homolog (S. cerevisiae) (CDC34) |
USD 436.00 |
|
TP303517 | Recombinant protein of human cell division cycle 34 homolog (S. cerevisiae) (CDC34), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review