DCUN1D1 (NM_020640) Human Mass Spec Standard

CAT#: PH303427

DCUN1D1 MS Standard C13 and N15-labeled recombinant protein (NP_065691)

Product Images

Coomassie blue staining of purified DCUN1D1 protein (Cat# TP303427). The protein was produced from HEK293T cells transfected with DCUN1D1 cDNA clone (Cat# RC203427) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203427
• Predicted MW: 30.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203427 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYN
  RYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQ
  IPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPK
  DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065691
• RefSeq Size: 3192
• RefSeq ORF: 777
• Synonyms: DCNL1; DCUN1L1; RP42; SCCRO; SCRO; Tes3
• Locus ID: 54165
• UniProt ID: Q96GG9, B4DM76
• Cytogenetics: 3q26.33
• Summary: Part of an E3 ubiquitin ligase complex for neddylation. Promotes neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes. Acts by binding to cullin-RBX1 complexes in the cytoplasm and promoting their nuclear translocation, enhancing recruitment of E2-NEDD8 (UBE2M-NEDD8) thioester to the complex, and optimizing the orientation of proteins in the complex to allow efficient transfer of NEDD8 from the E2 to the cullin substrates. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity (PubMed:25349211, PubMed:28581483). Acts also as an oncogene facilitating malignant transformation and carcinogenic progression (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome