ASAM (CLMP) (NM_024769) Human Mass Spec Standard

CAT#: PH303362

ASAM MS Standard C13 and N15-labeled recombinant protein (NP_079045)

Product Images

Coomassie blue staining of purified CLMP protein (Cat# TP303362). The protein was produced from HEK293T cells transfected with CLMP cDNA clone (Cat# RC203362) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203362
• Predicted MW: 41.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203362 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRH
  VYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELE
  GELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTA
  GNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAP
  KARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHH
  ANLTKAETTPSMIPSQSRAFQTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079045
• RefSeq Size: 2645
• RefSeq ORF: 1119
• Synonyms: ACAM; ASAM; CSBM; CSBS
• Locus ID: 79827
• UniProt ID: Q9H6B4, B4E3S3
• Cytogenetics: 11q24.1
• Summary: This gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte maturation and development of obesity. This gene is also essential for normal intestinal development and mutations in the gene are associated with congenital short bowel syndrome. [provided by RefSeq, Aug 2015]
• Protein Families: Transmembrane