UXS 1 (UXS1) (NM_025076) Human Mass Spec Standard

CAT#: PH303354

UXS1 MS Standard C13 and N15-labeled recombinant protein (NP_079352)

Product Images

Coomassie blue staining of purified UXS1 protein (Cat# TP303354). The protein was produced from HEK293T cells transfected with UXS1 cDNA clone (Cat# RC203354) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203354
• Predicted MW: 47.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203354 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLE
  KSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFEL
  INHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPE
  VHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQ
  ALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQF
  LSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079352
• RefSeq Size: 2102
• RefSeq ORF: 1260
• Synonyms: SDR6E1; UGD
• Locus ID: 80146
• UniProt ID: Q8NBZ7
• Cytogenetics: 2q12.2
• Summary: This gene encodes an enzyme found in the perinuclear Golgi which catalyzes the synthesis of UDP-xylose used in glycosaminoglycan (GAG) synthesis on proteoglycans. The GAG chains are covalently attached to proteoglycans which participate in signaling pathways during development. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2014]
• Protein Families: Transmembrane
• Protein Pathways: Amino sugar and nucleotide sugar metabolism, Metabolic pathways, Starch and sucrose metabolism