MNF1 (UQCC2) (NM_032340) Human Mass Spec Standard
CAT#: PH303347
C6orf125 MS Standard C13 and N15-labeled recombinant protein (NP_115716)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203347 |
Predicted MW | 14.9 kDa |
Protein Sequence |
>RC203347 protein sequence
Red=Cloning site Green=Tags(s) MAASRYRRFLKLCEEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKH KYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115716 |
RefSeq Size | 1355 |
RefSeq ORF | 378 |
Synonyms | bA6B20.2; C6orf125; C6orf126; Cbp6; M19; MC3DN7; MNF1 |
Locus ID | 84300 |
UniProt ID | Q9BRT2 |
Cytogenetics | 6p21.31 |
Summary | This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity. [provided by RefSeq, Oct 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410177 | UQCC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410177 | Transient overexpression lysate of chromosome 6 open reading frame 125 (C6orf125) |
USD 436.00 |
|
TP303347 | Recombinant protein of human chromosome 6 open reading frame 125 (C6orf125), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review