SLD5 (GINS4) (NM_032336) Human Mass Spec Standard

CAT#: PH303336

GINS4 MS Standard C13 and N15-labeled recombinant protein (NP_115712)

Product Images

Coomassie blue staining of purified GINS4 protein (Cat# TP303336). The protein was produced from HEK293T cells transfected with GINS4 cDNA clone (Cat# RC203336) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203336
• Predicted MW: 26 kDa
• Protein Sequence:
  Sequence Link

  >RC203336 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR
  EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY
  LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT
  IAPLVASGAVQLI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115712
• RefSeq Size: 3841
• RefSeq ORF: 669
• Synonyms: SLD5
• Locus ID: 84296
• UniProt ID: Q9BRT9
• Cytogenetics: 8p11.21
• Summary: The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM, Mar 2008]