Melanoma Inhibitory Activity (MIA) (NM_006533) Human Mass Spec Standard
CAT#: PH303245
MIA MS Standard C13 and N15-labeled recombinant protein (NP_006524)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203245 |
Predicted MW | 14.5 kDa |
Protein Sequence |
>RC203245 protein sequence
Red=Cloning site Green=Tags(s) MARSLVCLGVIILLSAFSGPGVRGGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVV YVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006524 |
RefSeq Size | 654 |
RefSeq ORF | 393 |
Synonyms | CD-RAP |
Locus ID | 8190 |
UniProt ID | Q16674, A0A024R0P1 |
Cytogenetics | 19q13.2 |
Summary | Elicits growth inhibition on melanoma cells in vitro as well as some other neuroectodermal tumors, including gliomas.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401957 | MIA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401957 | Transient overexpression lysate of melanoma inhibitory activity (MIA) |
USD 436.00 |
|
TP303245 | Recombinant protein of human melanoma inhibitory activity (MIA), 20 µg |
USD 867.00 |
|
TP720129 | Recombinant protein of human melanoma inhibitory activity (MIA) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review