PDE6D (NM_002601) Human Mass Spec Standard
CAT#: PH303172
PDE6D MS Standard C13 and N15-labeled recombinant protein (NP_002592)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203172 |
Predicted MW | 17.4 kDa |
Protein Sequence |
>RC203172 protein sequence
Red=Cloning site Green=Tags(s) MSAKDERAREILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSTEQ MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV STSRVRLFYV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002592 |
RefSeq Size | 1214 |
RefSeq ORF | 450 |
Synonyms | JBTS22; PDED |
Locus ID | 5147 |
UniProt ID | O43924, Q6IB24 |
Cytogenetics | 2q37.1 |
Summary | This gene encodes the delta subunit of rod-specific photoreceptor phosphodiesterase (PDE), a key enzyme in the phototransduction cascade. A similar protein in cow functions in solubilizing membrane-bound PDE. In addition to its role in the PDE complex, the encoded protein is thought to bind to prenyl groups of proteins to target them to subcellular organelles called cilia. Mutations in this gene are associated with Joubert syndrome-22. Alternative splicing results in multiple splice variants. [provided by RefSeq, Mar 2014] |
Protein Pathways | Progesterone-mediated oocyte maturation, Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419219 | PDE6D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419219 | Transient overexpression lysate of phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D) |
USD 436.00 |
|
TP303172 | Recombinant protein of human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), 20 µg |
USD 867.00 |
|
TP760649 | Purified recombinant protein of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
|
TP761964 | Purified recombinant protein of Human phosphodiesterase 6D, cGMP-specific, rod, delta (PDE6D),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review