SR1 (SRI) (NM_003130) Human Mass Spec Standard
CAT#: PH303130
SRI MS Standard C13 and N15-labeled recombinant protein (NP_003121)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203130 |
Predicted MW | 21.7 kDa |
Protein Sequence |
>RC203130 protein sequence
Red=Cloning site Green=Tags(s) MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPF NLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQA VNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003121 |
RefSeq Size | 2036 |
RefSeq ORF | 594 |
Synonyms | CP-22; CP22; SCN; V19 |
Locus ID | 6717 |
UniProt ID | P30626, B4DHQ6 |
Cytogenetics | 7q21.12 |
Summary | This gene encodes a calcium-binding protein with multiple E-F hand domains that relocates from the cytoplasm to the sarcoplasmic reticulum in response to elevated calcium levels. In addition to regulating intracellular calcium homeostasis it also modulates excitation-contraction coupling in the heart. Alternative splicing results in multiple transcript variants encoding distinct proteins. Multiple pseudogenes exist for this gene. [provided by RefSeq, Mar 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401087 | SRI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC403696 | SRI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401087 | Transient overexpression lysate of sorcin (SRI), transcript variant 1 |
USD 436.00 |
|
LY403696 | Transient overexpression lysate of sorcin (SRI), transcript variant 2 |
USD 436.00 |
|
PH322838 | SRI MS Standard C13 and N15-labeled recombinant protein (NP_944490) |
USD 3,255.00 |
|
TP303130 | Recombinant protein of human sorcin (SRI), transcript variant 1, 20 µg |
USD 867.00 |
|
TP322838 | Recombinant protein of human sorcin (SRI), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review