MURF2 (TRIM55) (NM_184086) Human Mass Spec Standard

CAT#: PH302934

TRIM55 MS Standard C13 and N15-labeled recombinant protein (NP_908974)

Product Images

Coomassie blue staining of purified TRIM55 protein (Cat# TP302934). The protein was produced from HEK293T cells transfected with TRIM55 cDNA clone (Cat# RC202934) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202934
• Predicted MW: 50.8 kDa
• Protein Sequence:
  Sequence Link

  >RC202934 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSASLNYKSFSKEQQTMDNLEKQLICPICLEMFTKPVVILPCQHNLCRKCASDIFQASNPYLPTRGGTTM
  ASGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESTRPEKKSDQPMCEEHEEERINIYCLNCE
  VPTCSLCKVFGAHKDCQVAPLTHVFQRQKSELSDGIAILVGSNDRVQGVISQLEDTCKTIEECCRKQKQE
  LCEKFDYLYGILEERKNEMTQVITRTQEEKLEHVRALIKKYSDHLENVSKLVESGIQFMDEPEMAVFLQN
  AKTLLKKISEASKAFQMEKIEHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVG
  GEAVEVEEVENVQTEFPGEDENPEKASELSQVELQAAPGALPVSSPEPPPALPPAADAPVTQIGFEAPPL
  QGQAAAPASGSGADSEPARHIFSFSWLNSLNE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_908974
• RefSeq Size: 2483
• RefSeq ORF: 1356
• Synonyms: MURF-2; muRF2; RNF29
• Locus ID: 84675
• UniProt ID: Q9BYV6, Q9BYV6-2
• Cytogenetics: 8q13.1
• Summary: The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]