AKR1A1 (NM_153326) Human Mass Spec Standard
CAT#: PH302813
AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_697021)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202813 |
Predicted MW | 36.6 kDa |
Protein Sequence |
>RC202813 protein sequence
Red=Cloning site Green=Tags(s) MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_697021 |
RefSeq Size | 1469 |
RefSeq ORF | 975 |
Synonyms | ALDR1; ALR; ARM; DD3; HEL-S-6 |
Locus ID | 10327 |
UniProt ID | P14550, V9HWI0 |
Cytogenetics | 1p34.1 |
Summary | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401826 | AKR1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC407047 | AKR1A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401826 | Transient overexpression lysate of aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1 |
USD 436.00 |
|
LY407047 | Transient overexpression lysate of aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2 |
USD 436.00 |
|
PH300302 | AKR1A1 MS Standard C13 and N15-labeled recombinant protein (NP_006057) |
USD 3,255.00 |
|
TP300302 | Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1, 20 µg |
USD 867.00 |
|
TP302813 | Recombinant protein of human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review