Caveolin 2 (CAV2) (NM_001233) Human Mass Spec Standard

CAT#: PH302703

CAV2 MS Standard C13 and N15-labeled recombinant protein (NP_001224)

Product Images

Coomassie blue staining of purified CAV2 protein (Cat# TP302703). The protein was produced from HEK293T cells transfected with CAV2 cDNA clone (Cat# RC202703) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202703
• Predicted MW: 18.1 kDa
• Protein Sequence:
  Sequence Link

  >RC202703 representing NM_001233
  Red=Cloning site Green=Tags(s)
  
  MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVW
  ICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVI
  IAPLCTSVGRCFSSVSLQLSQD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001224
• RefSeq Size: 3332
• RefSeq ORF: 486
• Synonyms: CAV
• Locus ID: 858
• UniProt ID: P51636, Q53X57
• Cytogenetics: 7q31.2
• Summary: The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. This gene and related family member (CAV1) are located next to each other on chromosome 7, and express colocalizing proteins that form a stable hetero-oligomeric complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Additional isoforms resulting from the use of alternate in-frame translation initiation codons have also been described, and shown to have preferential localization in the cell (PMID:11238462). [provided by RefSeq, May 2011]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Focal adhesion