OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NME4 (NM_005009) Human Mass Spec Standard

Be the first to review this product
SKU
PH302603
NME4 MS Standard C13 and N15-labeled recombinant protein (NP_005000)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501110 Anti-NME4 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5) 100 ul
$447.00
LY401559 Transient overexpression lysate of non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00

Other products for "NME4 or NM_005009"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202603
Predicted MW 20.7 kDa
Protein Sequence
Protein Sequence
>RC202603 protein sequence
Red=Cloning site Green=Tags(s)

MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG
MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD
FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005000
RefSeq Size 1059
RefSeq ORF 561
Synonyms NDPK-D; nm23-H4; NM23H4
Locus ID 4833
UniProt ID O00746
Cytogenetics 16p13.3
Summary The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 PubMed 9099850).supplied by OMIM, May 2008
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NME4" proteins (3)
SKU Description Size Price
LC401559 Lyophilized NME4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401559 Transient overexpression lysate of non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein (as WB positive control) 100 ug
$436.00
TP302603 Recombinant protein of human non-metastatic cells 4, protein expressed in (NME4), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products