NME4 (NM_005009) Human Mass Spec Standard

CAT#: PH302603

NME4 MS Standard C13 and N15-labeled recombinant protein (NP_005000)

Product Images

Coomassie blue staining of purified NME4 protein (Cat# TP302603). The protein was produced from HEK293T cells transfected with NME4 cDNA clone (Cat# RC202603) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202603
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC202603 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG
  MKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGD
  FSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005000
• RefSeq Size: 1059
• RefSeq ORF: 561
• Synonyms: NDPK-D; nm23-H4; NM23H4
• Locus ID: 4833
• UniProt ID: O00746
• Cytogenetics: 16p13.3
• Summary: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Purine metabolism, Pyrimidine metabolism