BLOC1S2 (NM_001001342) Human Mass Spec Standard

CAT#: PH302351

BLOC1S2 MS Standard C13 and N15-labeled recombinant protein (NP_001001342)

Product Images

Coomassie blue staining of purified BLOC1S2 protein (Cat# TP302351). The protein was produced from HEK293T cells transfected with BLOC1S2 cDNA clone (Cat# RC202351) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202351
• Predicted MW: 11.5 kDa
• Protein Sequence:
  Sequence Link

  >RC202351 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEE
  QVAALEQAAYKLDAYSKKLEAKYKKLEKR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001001342
• RefSeq Size: 2722
• RefSeq ORF: 297
• Synonyms: BLOS2; BORCS2; CEAP; CEAP11
• Locus ID: 282991
• UniProt ID: Q6QNY1
• Cytogenetics: 10q24.31
• Summary: This gene encodes a protein with multiple functions. The encoded protein has been found in association with the centrosome, shown to co-localize with gamma-tubulin, and also found to be one of the proteins in the BLOC-1 complex which functions in the formation of lysosome-related organelles. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012]