BLOC1S2 (NM_001001342) Human Mass Spec Standard
CAT#: PH302351
BLOC1S2 MS Standard C13 and N15-labeled recombinant protein (NP_001001342)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202351 |
Predicted MW | 11.5 kDa |
Protein Sequence |
>RC202351 protein sequence
Red=Cloning site Green=Tags(s) MFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEE QVAALEQAAYKLDAYSKKLEAKYKKLEKR myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001001342 |
RefSeq Size | 2722 |
RefSeq ORF | 297 |
Synonyms | BLOS2; BORCS2; CEAP; CEAP11 |
Locus ID | 282991 |
UniProt ID | Q6QNY1 |
Cytogenetics | 10q24.31 |
Summary | This gene encodes a protein with multiple functions. The encoded protein has been found in association with the centrosome, shown to co-localize with gamma-tubulin, and also found to be one of the proteins in the BLOC-1 complex which functions in the formation of lysosome-related organelles. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424327 | BLOC1S2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424327 | Transient overexpression lysate of biogenesis of lysosomal organelles complex-1, subunit 2 (BLOC1S2), transcript variant 2 |
USD 436.00 |
|
TP302351 | Recombinant protein of human biogenesis of lysosomal organelles complex-1, subunit 2 (BLOC1S2), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review