ARHGAP1 (NM_004308) Human Mass Spec Standard

CAT#: PH301966

ARHGAP1 MS Standard C13 and N15-labeled recombinant protein (NP_004299)

Product Images

Coomassie blue staining of purified ARHGAP1 protein (Cat# TP301966). The protein was produced from HEK293T cells transfected with ARHGAP1 cDNA clone (Cat# RC201966) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201966
• Predicted MW: 50.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201966 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARH
  QIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWL
  RDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPRQV
  LKYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGI
  FRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRV
  PATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT
  KFLLDHQGELFPSPDPSGL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004299
• RefSeq Size: 3460
• RefSeq ORF: 1317
• Synonyms: CDC42GAP; p50rhoGAP; RHOGAP; RHOGAP1
• Locus ID: 392
• UniProt ID: Q07960
• Cytogenetics: 11p11.2
• Summary: This gene encodes a member of a large family of proteins that activate Rho-type guanosine triphosphate (GTP) metabolizing enzymes. The encoded protein contains a SRC homology 3 domain and interacts with Bcl-2-associated protein family members. [provided by RefSeq, Aug 2012]