DCTN6 (NM_006571) Human Mass Spec Standard

CAT#: PH301937

DCTN6 MS Standard C13 and N15-labeled recombinant protein (NP_006562)

Product Images

Coomassie blue staining of purified DCTN6 protein (Cat# TP301937). The protein was produced from HEK293T cells transfected with DCTN6 cDNA clone (Cat# RC201937) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201937
• Predicted MW: 20.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201937 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNI
  TPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPEN
  TVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006562
• RefSeq Size: 1126
• RefSeq ORF: 570
• Synonyms: p27; WS-3; WS3
• Locus ID: 10671
• UniProt ID: O00399
• Cytogenetics: 8p12
• Summary: The protein encoded by this gene contains an RGD (Arg-Gly-Asp) motif in the N-terminal region, which confers adhesive properties to macromolecular proteins like fibronectin. It shares a high degree of sequence similarity with the mouse homolog, which has been suggested to play a role in mitochondrial biogenesis. The exact biological function of this gene is not known. [provided by RefSeq, Jul 2008]