COX7C (NM_001867) Human Mass Spec Standard
CAT#: PH301768
COX7C MS Standard C13 and N15-labeled recombinant protein (NP_001858)
USD 436.00
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201768 |
Predicted MW | 7.2 kDa |
Protein Sequence |
>RC201768 protein sequence
Red=Cloning site Green=Tags(s) MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001858 |
RefSeq Size | 448 |
RefSeq ORF | 189 |
Locus ID | 1350 |
UniProt ID | P15954 |
Cytogenetics | 5q14.3 |
Summary | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419695 | COX7C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419695 | Transient overexpression lysate of cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
TP301768 | Recombinant protein of human cytochrome c oxidase subunit VIIc (COX7C), nuclear gene encoding mitochondrial protein, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review