OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SNRPD2 (NM_004597) Human Mass Spec Standard

Be the first to review this product
SKU
PH301736
SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345887 Rabbit Polyclonal Anti-SNRPD2 Antibody
100 ul
$585.00
LY406078 Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SNRPD2 or NM_004597"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201736
Predicted MW 13.5 kDa
Protein Sequence
Protein Sequence
>RC201736 protein sequence
Red=Cloning site Green=Tags(s)

MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV
KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004588
RefSeq Size 767
RefSeq ORF 354
Synonyms Sm-D2; SMD2; SNRPD1
Locus ID 6633
UniProt ID P62316
Cytogenetics 19q13.32
Summary The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, May 2009
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SNRPD2" proteins (5)
SKU Description Size Price
LC406078 Lyophilized SNRPD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417879 Lyophilized SNRPD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406078 Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY417879 Transient overexpression lysate of small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301736 Recombinant protein of human small nuclear ribonucleoprotein D2 polypeptide 16.5kDa (SNRPD2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products