SNRPD2 (NM_004597) Human Mass Spec Standard

CAT#: PH301736

SNRPD2 MS Standard C13 and N15-labeled recombinant protein (NP_004588)

Product Images

Coomassie blue staining of purified SNRPD2 protein (Cat# TP301736). The protein was produced from HEK293T cells transfected with SNRPD2 cDNA clone (Cat# RC201736) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201736
• Predicted MW: 13.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201736 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENV
  KEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004588
• RefSeq Size: 767
• RefSeq ORF: 354
• Synonyms: Sm-D2; SMD2; SNRPD1
• Locus ID: 6633
• UniProt ID: P62316
• Cytogenetics: 19q13.32
• Summary: The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]
• Protein Pathways: Spliceosome