SSX1 (NM_005635) Human Mass Spec Standard

CAT#: PH301600

SSX1 MS Standard C13 and N15-labeled recombinant protein (NP_005626)

Product Images

Coomassie blue staining of purified SSX1 protein (Cat# TP301600). The protein was produced from HEK293T cells transfected with SSX1 cDNA clone (Cat# RC201600) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201600
• Predicted MW: 21.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201600 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPF
  MCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLH
  PPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005626
• RefSeq Size: 1316
• RefSeq ORF: 564
• Synonyms: CT5.1; SSRC
• Locus ID: 6756
• UniProt ID: Q16384
• Cytogenetics: Xp11.23
• Summary: The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. This gene, and also the SSX2 and SSX4 family members, have been involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are likely responsible for transforming activity. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome X. [provided by RefSeq, Jul 2013]
• Protein Families: Transcription Factors