OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Apolipoprotein O (APOO) (NM_024122) Human Mass Spec Standard

Be the first to review this product
SKU
PH301451
APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343926 Rabbit Polyclonal Anti-FAM121B Antibody
100 ul
$525.00
LY411353 Transient overexpression lysate of apolipoprotein O (APOO), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "Apolipoprotein O or NM_024122"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201451
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC201451 protein sequence
Red=Cloning site Green=Tags(s)

MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY
CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP
GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077027
RefSeq Size 1134
RefSeq ORF 594
Synonyms FAM121B; Mic23; MIC26; MICOS26; My025
Locus ID 79135
UniProt ID Q9BUR5
Cytogenetics Xp22.11
Summary This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.provided by RefSeq, Sep 2009
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Apolipoprotein O" proteins (3)
SKU Description Size Price
LC411353 Lyophilized APOO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411353 Transient overexpression lysate of apolipoprotein O (APOO), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301451 Recombinant protein of human apolipoprotein O (APOO), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products