Apolipoprotein O (APOO) (NM_024122) Human Mass Spec Standard

CAT#: PH301451

APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027)

Product Images

Coomassie blue staining of purified APOO protein (Cat# TP301451). The protein was produced from HEK293T cells transfected with APOO cDNA clone (Cat# RC201451) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201451
• Predicted MW: 22.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201451 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY
  CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP
  GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_077027
• RefSeq Size: 1134
• RefSeq ORF: 594
• Synonyms: FAM121B; Mic23; MIC26; MICOS26; My025
• Locus ID: 79135
• UniProt ID: Q9BUR5
• Cytogenetics: Xp22.11
• Summary: This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.[provided by RefSeq, Sep 2009]
• Protein Families: Secreted Protein, Transmembrane