GRCC10 (C12orf57) (NM_138425) Human Mass Spec Standard

CAT#: PH301441

C12orf57 MS Standard C13 and N15-labeled recombinant protein (NP_612434)

Product Images

Coomassie blue staining of purified C12orf57 protein (Cat# TP301441). The protein was produced from HEK293T cells transfected with C12orf57 cDNA clone (Cat# RC201441) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201441
• Predicted MW: 13.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201441 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYG
  FSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612434
• RefSeq Size: 794
• RefSeq ORF: 378
• Synonyms: C10; GRCC10
• Locus ID: 113246
• UniProt ID: Q99622
• Cytogenetics: 12p13.31
• Summary: This gene is ubiquitously expressed in human tissues. It is required for development of the human corpus callosum. Mutations in this gene are associated with Temtamy syndrome (TEMTYS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]