Morg1 (WDR83) (NM_032332) Human Mass Spec Standard

CAT#: PH301323

WDR83 MS Standard C13 and N15-labeled recombinant protein (NP_115708)

Product Images

Coomassie blue staining of purified WDR83 protein (Cat# TP301323). The protein was produced from HEK293T cells transfected with WDR83 cDNA clone (Cat# RC201323) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201323
• Predicted MW: 34.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201323 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEV
  LDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRS
  RRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSS
  LDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVV
  QSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115708
• RefSeq Size: 1219
• RefSeq ORF: 945
• Synonyms: MORG1
• Locus ID: 84292
• UniProt ID: Q9BRX9
• Cytogenetics: 19p13.13
• Summary: This gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]