Sarcosine Oxidase (PIPOX) (NM_016518) Human Mass Spec Standard

CAT#: PH301274

PIPOX MS Standard C13 and N15-labeled recombinant protein (NP_057602)

Product Images

Coomassie blue staining of purified PIPOX protein (Cat# TP301274). The protein was produced from HEK293T cells transfected with PIPOX cDNA clone (Cat# RC201274) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201274
• Predicted MW: 44.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201274 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHE
  CYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVG
  LLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLL
  RPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADP
  EERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG
  FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057602
• RefSeq Size: 2412
• RefSeq ORF: 1170
• Synonyms: LPIPOX
• Locus ID: 51268
• UniProt ID: Q9P0Z9
• Cytogenetics: 17q11.2
• Summary: Metabolizes sarcosine, L-pipecolic acid and L-proline.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Glycine, serine and threonine metabolism, Lysine degradation, Metabolic pathways