BAT4 (GPANK1) (NM_033177) Human Mass Spec Standard

CAT#: PH301161

BAT4 MS Standard C13 and N15-labeled recombinant protein (NP_149417)

Product Images

Coomassie blue staining of purified GPANK1 protein (Cat# TP301161). The protein was produced from HEK293T cells transfected with GPANK1 cDNA clone (Cat# RC201161) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201161
• Predicted MW: 39.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201161 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRPLLITFTPATDPSDLWKDGQQQPQPEKPESTLDGAAARAFYEALIGDESSAPDSQRSQTEPARERKR
  KKRRIMKAPAAEAVAEGASGRHGQGRSLEAEDKMTHRILRAAQEGDLPELRRLLEPHEAGGAGGNINARD
  AFWWTPLMCAARAGQGAAVSYLLGRGAAWVGVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRS
  PTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEG
  RANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRT
  YMNLEF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_149417
• RefSeq Size: 2769
• RefSeq ORF: 1068
• Synonyms: ANKRD59; BAT4; D6S54E; G5; GPATCH10
• Locus ID: 7918
• UniProt ID: O95872, A0A024RCU2
• Cytogenetics: 6p21.33
• Summary: This gene is located in a cluster of HLA-B-associated transcripts, which is included in the human major histocompatability complex III region. This gene encodes a protein which is thought to play a role in immunity. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2010]