UBE2G1 (NM_003342) Human Mass Spec Standard

CAT#: PH301159

UBE2G1 MS Standard C13 and N15-labeled recombinant protein (NP_003333)

Product Images

Coomassie blue staining of purified UBE2G1 protein (Cat# TP301159). The protein was produced from HEK293T cells transfected with UBE2G1 cDNA clone (Cat# RC201159) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201159
• Predicted MW: 19.3 kDa
• Protein Sequence:
  Sequence Link

  >RC201159 representing NM_003342
  Red=Cloning site Green=Tags(s)
  
  MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPP
  KMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVD
  AAKEWREDRNGEFKRKVARCVRKSQETAFE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003333
• RefSeq Size: 4208
• RefSeq ORF: 510
• Synonyms: E217K; UBC7; UBE2G
• Locus ID: 7326
• UniProt ID: P62253
• Cytogenetics: 17p13.2
• Summary: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins. [provided by RefSeq, Jul 2008]
• Protein Pathways: Parkinson's disease, Ubiquitin mediated proteolysis