NSFL1C (NM_016143) Human Mass Spec Standard
CAT#: PH301022
NSFL1C MS Standard C13 and N15-labeled recombinant protein (NP_057227)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201022 |
Predicted MW | 40.6 kDa |
Protein Sequence |
>RC201022 protein sequence
Red=Cloning site Green=Tags(s) MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDN RVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKS PGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDVHVVLKLWKSGFSLDNGELRSYQDPSNAQFL ESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENE AKASSSILIDESEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELAD ESQTLKEANLLNAVIVQRLT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057227 |
RefSeq Size | 3568 |
RefSeq ORF | 1110 |
Synonyms | dJ776F14.1; P47; UBX1; UBXD10; UBXN2C |
Locus ID | 55968 |
UniProt ID | Q9UNZ2, Q53FE8 |
Cytogenetics | 20p13 |
Summary | N-ethylmaleimide-sensitive factor (NSF) and valosin-containing protein (p97) are two ATPases known to be involved in transport vesicle/target membrane fusion and fusions between membrane compartments. A trimer of the protein encoded by this gene binds a hexamer of cytosolic p97 and is required for p97-mediated regrowth of Golgi cisternae from mitotic Golgi fragments. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8. [provided by RefSeq, May 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402508 | NSFL1C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC412879 | NSFL1C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402508 | Transient overexpression lysate of NSFL1 (p97) cofactor (p47) (NSFL1C), transcript variant 1 |
USD 436.00 |
|
LY412879 | Transient overexpression lysate of NSFL1 (p97) cofactor (p47) (NSFL1C), transcript variant 2 |
USD 436.00 |
|
TP301022 | Recombinant protein of human NSFL1 (p97) cofactor (p47) (NSFL1C), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review