GGCT (NM_024051) Human Mass Spec Standard
CAT#: PH300962
GGCT MS Standard C13 and N15-labeled recombinant protein (NP_076956)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200962 |
Predicted MW | 21 kDa |
Protein Sequence |
>RC200962 protein sequence
Red=Cloning site Green=Tags(s) MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIAT IFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYK KIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_076956 |
RefSeq Size | 1197 |
RefSeq ORF | 564 |
Synonyms | C7orf24; CRF21; GCTG; GGC |
Locus ID | 79017 |
UniProt ID | O75223, A0A090N7V5 |
Cytogenetics | 7p14.3 |
Summary | The protein encoded by this gene catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides, the penultimate step in glutathione catabolism, and may play a critical role in glutathione homeostasis. The encoded protein may also play a role in cell proliferation, and the expression of this gene is a potential marker for cancer. Pseudogenes of this gene are located on the long arm of chromosome 5 and the short arm of chromosomes 2 and 20. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2010] |
Protein Pathways | Glutathione metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411391 | GGCT HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411391 | Transient overexpression lysate of gamma-glutamyl cyclotransferase (GGCT) |
USD 436.00 |
|
TP300962 | Recombinant protein of human gamma-glutamyl cyclotransferase (GGCT), 20 µg |
USD 867.00 |
|
TP720189 | Recombinant protein of human gamma-glutamyl cyclotransferase (GGCT) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review