GGCT (NM_024051) Human Mass Spec Standard

CAT#: PH300962

GGCT MS Standard C13 and N15-labeled recombinant protein (NP_076956)

Product Images

Coomassie blue staining of purified GGCT protein (Cat# TP300962). The protein was produced from HEK293T cells transfected with GGCT cDNA clone (Cat# RC200962) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200962
• Predicted MW: 21 kDa
• Protein Sequence:
  Sequence Link

  >RC200962 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MANSGCKDVTGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKTSQTWHGGIAT
  IFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGKEITCRSYLMTNYESAPPSPQYK
  KIICMGAKENGLPLEYQEKLKAIEPNDYTGKVSEEIEDIIKKGETQTL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_076956
• RefSeq Size: 1197
• RefSeq ORF: 564
• Synonyms: C7orf24; CRF21; GCTG; GGC
• Locus ID: 79017
• UniProt ID: O75223, A0A090N7V5
• Cytogenetics: 7p14.3
• Summary: The protein encoded by this gene catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides, the penultimate step in glutathione catabolism, and may play a critical role in glutathione homeostasis. The encoded protein may also play a role in cell proliferation, and the expression of this gene is a potential marker for cancer. Pseudogenes of this gene are located on the long arm of chromosome 5 and the short arm of chromosomes 2 and 20. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2010]
• Protein Pathways: Glutathione metabolism