SDF2 (NM_006923) Human Mass Spec Standard

CAT#: PH300939

SDF2 MS Standard C13 and N15-labeled recombinant protein (NP_008854)

Product Images

Coomassie blue staining of purified SDF2 protein (Cat# TP300939). The protein was produced from HEK293T cells transfected with SDF2 cDNA clone (Cat# RC200939) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200939
• Predicted MW: 23 kDa
• Protein Sequence:
  Sequence Link

  >RC200939 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYW
  RIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGP
  YWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAE
  L
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008854
• RefSeq Size: 1565
• RefSeq ORF: 633
• Locus ID: 6388
• UniProt ID: Q99470, Q6IBU4
• Cytogenetics: 17q11.2
• Summary: The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15. [provided by RefSeq, Dec 2011]
• Protein Families: Secreted Protein