OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SDF2 (NM_006923) Human Mass Spec Standard

Be the first to review this product
SKU
PH300939
SDF2 MS Standard C13 and N15-labeled recombinant protein (NP_008854)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346863 Rabbit Polyclonal Anti-SDF2 Antibody
100 ul
$525.00
LY416324 Transient overexpression lysate of stromal cell-derived factor 2 (SDF2) (as WB positive control) 100 ug
$436.00

Other products for "SDF2 or NM_006923"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200939
Predicted MW 23 kDa
Protein Sequence
Protein Sequence
>RC200939 protein sequence
Red=Cloning site Green=Tags(s)

MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYW
RIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGP
YWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAE
L

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_008854
RefSeq Size 1565
RefSeq ORF 633
Locus ID 6388
UniProt ID Q99470
Cytogenetics 17q11.2
Summary The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15. provided by RefSeq, Dec 2011
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SDF2" proteins (3)
SKU Description Size Price
LC416324 Lyophilized SDF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416324 Transient overexpression lysate of stromal cell-derived factor 2 (SDF2) (as WB positive control) 100 ug
$436.00
TP300939 Recombinant protein of human stromal cell-derived factor 2 (SDF2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products