THTPA (NM_024328) Human Mass Spec Standard

CAT#: PH300849

THTPA MS Standard C13 and N15-labeled recombinant protein (NP_077304)

Product Images

Coomassie blue staining of purified THTPA protein (Cat# TP300849). The protein was produced from HEK293T cells transfected with THTPA cDNA clone (Cat# RC200849) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200849
• Predicted MW: 25.6 kDa
• Protein Sequence:
  Sequence Link

  >RC200849 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAA
  GVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEP
  QLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLL
  EVNSSRERPQETEDPDHCLG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_077304
• RefSeq Size: 2228
• RefSeq ORF: 690
• Synonyms: THTP; THTPASE
• Locus ID: 79178
• UniProt ID: Q9BU02
• Cytogenetics: 14q11.2
• Summary: This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]
• Protein Pathways: Metabolic pathways, Thiamine metabolism