NDUFB7 (NM_004146) Human Mass Spec Standard

CAT#: PH300784

NDUFB7 MS Standard C13 and N15-labeled recombinant protein (NP_004137)

Product Images

Coomassie blue staining of purified NDUFB7 protein (Cat# TP300784). The protein was produced from HEK293T cells transfected with NDUFB7 cDNA clone (Cat# RC200784) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200784
• Predicted MW: 16.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200784 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCK
  RDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004137
• RefSeq Size: 573
• RefSeq ORF: 411
• Synonyms: B18; CI-B18
• Locus ID: 4713
• UniProt ID: P17568
• Cytogenetics: 19p13.12
• Summary: The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq, Jul 2008]
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease