HMGB2 (NM_002129) Human Mass Spec Standard
CAT#: PH300750
HMGB2 MS Standard C13 and N15-labeled recombinant protein (NP_002120)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200750 |
Predicted MW | 24 kDa |
Protein Sequence |
>RC200750 protein sequence
Red=Cloning site Green=Tags(s) MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKAR YDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKD KQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002120 |
RefSeq Size | 1527 |
RefSeq ORF | 627 |
Synonyms | HMG2 |
Locus ID | 3148 |
UniProt ID | P26583 |
Cytogenetics | 4q34.1 |
Summary | This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419515 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427242 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427243 | HMGB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419515 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 1 |
USD 436.00 |
|
LY427242 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 2 |
USD 436.00 |
|
LY427243 | Transient overexpression lysate of high-mobility group box 2 (HMGB2), transcript variant 3 |
USD 436.00 |
|
TP300750 | Recombinant protein of human high-mobility group box 2 (HMGB2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP720732 | Purified recombinant protein of Human high mobility group box 2 (HMGB2), transcript variant 1 |
USD 330.00 |
|
TP760625 | Purified recombinant protein of Human high mobility group box 2 (HMGB2), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review