PCLAF (NM_014736) Human Mass Spec Standard

CAT#: PH300694

KIAA0101 MS Standard C13 and N15-labeled recombinant protein (NP_055551)

Product Images

Coomassie blue staining of purified PCLAF protein (Cat# TP300694). The protein was produced from HEK293T cells transfected with PCLAF cDNA clone (Cat# RC200694) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200694
• Predicted MW: 12 kDa
• Protein Sequence:
  Sequence Link

  >RC200694 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR
  LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055551
• RefSeq Size: 1515
• RefSeq ORF: 333
• Synonyms: KIAA0101; L5; NS5ATP9; OEATC; OEATC-1; OEATC1; p15(PAF); p15/PAF; p15PAF; PAF; PAF15
• Locus ID: 9768
• UniProt ID: Q15004
• Cytogenetics: 15q22.31
• Summary: PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome