TRAPPC3 (NM_014408) Human Mass Spec Standard

CAT#: PH300602

TRAPPC3 MS Standard C13 and N15-labeled recombinant protein (NP_055223)

Product Images

Coomassie blue staining of purified TRAPPC3 protein (Cat# TP300602). The protein was produced from HEK293T cells transfected with TRAPPC3 cDNA clone (Cat# RC200602) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200602
• Predicted MW: 20.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200602 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHD
  FRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALE
  MVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055223
• RefSeq Size: 1333
• RefSeq ORF: 540
• Synonyms: BET3
• Locus ID: 27095
• UniProt ID: O43617
• Cytogenetics: 1p34.3
• Summary: This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. The encoded protein participates in the regulation of transport from the endoplasmic reticulum to the Golgi apparatus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]