Adrenomedullin (ADM) (NM_001124) Human Mass Spec Standard
CAT#: PH300507
ADM MS Standard C13 and N15-labeled recombinant protein (NP_001115)
Frequently bought together (2)
Other products for "Adrenomedullin"
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200507 |
Predicted MW | 20.4 kDa |
Protein Sequence |
>RC200507 protein sequence
Red=Cloning site Green=Tags(s) MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVKAGPAQTLIRP QDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSK ISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001115 |
RefSeq Size | 1606 |
RefSeq ORF | 555 |
Synonyms | AM; PAMP |
Locus ID | 133 |
UniProt ID | P35318 |
Cytogenetics | 11p15.4 |
Summary | The protein encoded by this gene is a preprohormone which is cleaved to form two biologically active peptides, adrenomedullin and proadrenomedullin N-terminal 20 peptide. Adrenomedullin is a 52 aa peptide with several functions, including vasodilation, regulation of hormone secretion, promotion of angiogenesis, and antimicrobial activity. The antimicrobial activity is antibacterial, as the peptide has been shown to kill E. coli and S. aureus at low concentration. [provided by RefSeq, Aug 2014] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.