ZNF174 (NM_001032292) Human Mass Spec Standard

CAT#: PH300400

ZNF174 MS Standard C13 and N15-labeled recombinant protein (NP_001027463)

Product Images

Coomassie blue staining of purified ZNF174 protein (Cat# TP300400). The protein was produced from HEK293T cells transfected with ZNF174 cDNA clone (Cat# RC200400) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200400
• Predicted MW: 26.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200400 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQL
  CRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQ
  GQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEL
  LIEKTDPNMATDELPCKLWLSFIA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001027463
• RefSeq Size: 1593
• RefSeq ORF: 702
• Synonyms: ZSCAN8
• Locus ID: 7727
• UniProt ID: Q15697
• Cytogenetics: 16p13.3
• Summary: This gene encodes a protein with three Cys2-His2-type zinc fingers in the carboxy-terminus, a putative nuclear localization signal, and an amino-terminus SCAN box which forms homodimers. This protein is believed to function as a transcriptional repressor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2016]
• Protein Families: Transcription Factors