TRK fused gene (TFG) (NM_001007565) Human Mass Spec Standard

CAT#: PH300293

TFG MS Standard C13 and N15-labeled recombinant protein (NP_001007566)

Product Images

Coomassie blue staining of purified TFG protein (Cat# TP300293). The protein was produced from HEK293T cells transfected with TFG cDNA clone (Cat# RC200293) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200293
• Predicted MW: 43.4 kDa
• Protein Sequence:
  Sequence Link

  >RC200293 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFD
  SSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDT
  VDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSI
  ASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQT
  GPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMA
  PSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001007566
• RefSeq Size: 1841
• RefSeq ORF: 1200
• Synonyms: HMSNP; SPG57; TF6; TRKT3
• Locus ID: 10342
• UniProt ID: Q92734
• Cytogenetics: 3q12.2
• Summary: There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene. [provided by RefSeq, Sep 2010]
• Protein Pathways: Pathways in cancer, Thyroid cancer