IPP 2 (PPP1R2) (NM_006241) Human Mass Spec Standard
CAT#: PH300280
PPP1R2 MS Standard C13 and N15-labeled recombinant protein (NP_006232)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200280 |
Predicted MW | 23 kDa |
Protein Sequence |
>RC200280 protein sequence
Red=Cloning site Green=Tags(s) MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDE PSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF EMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_006232 |
RefSeq Size | 3468 |
RefSeq ORF | 615 |
Synonyms | IPP-2; IPP2; PPP1R2A |
Locus ID | 5504 |
UniProt ID | P41236 |
Cytogenetics | 3q29 |
Summary | Protein phosphatase-1 (PP1) is one of the main eukaryotic serine/threonine phosphatases. The protein encoded by this gene binds to the catalytic subunit of PP1, strongly inhibiting its activity. Ten related pseudogenes have been found throughout the human genome. Several splice variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401878 | PPP1R2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401878 | Transient overexpression lysate of protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2) |
USD 436.00 |
|
TP300280 | Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 2 (PPP1R2), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review