DNAJB11 (NM_016306) Human Mass Spec Standard

CAT#: PH300216

DNAJB11 MS Standard C13 and N15-labeled recombinant protein (NP_057390)

Product Images

Coomassie blue staining of purified DNAJB11 protein (Cat# TP300216). The protein was produced from HEK293T cells transfected with DNAJB11 cDNA clone (Cat# RC200216) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200216
• Predicted MW: 40.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200216 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDL
  GAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEV
  TLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
  EIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHL
  DGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQK
  VYNGLQGY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057390
• RefSeq Size: 1698
• RefSeq ORF: 1074
• Synonyms: ABBP-2; ABBP2; Dj-9; DJ9; EDJ; ERdj3; ERj3; ERj3p; PKD6; PRO1080; UNQ537
• Locus ID: 51726
• UniProt ID: Q9UBS4
• Cytogenetics: 3q27.3
• Summary: This gene encodes a soluble glycoprotein of the endoplasmic reticulum (ER) lumen that functions as a co-chaperone of binding immunoglobulin protein, a 70 kilodalton heat shock protein chaperone required for the proper folding and assembly of proteins in the ER. The encoded protein contains a highly conserved J domain of about 70 amino acids with a characteristic His-Pro-Asp (HPD) motif and may regulate the activity of binding immunoglobulin protein by stimulating ATPase activity. [provided by RefSeq, Mar 2014]
• Protein Families: Transmembrane