PIMREG (NM_019013) Human Mass Spec Standard

CAT#: PH300148

FAM64A MS Standard C13 and N15-labeled recombinant protein (NP_061886)

Product Images

Coomassie blue staining of purified PIMREG protein (Cat# TP300148). The protein was produced from HEK293T cells transfected with PIMREG cDNA clone (Cat# RC200148) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200148
• Predicted MW: 26.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200148 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASRWQNMGTSVRRRSLQHQEQLEDSKELQPVVSHQETSVGALGSLCRQFQRRLPLRAVNLNLRAGPSWK
  RLETPEPGQQGLQAAARSAKSALGAVSQRIQESCQSGTKWLVETQVKARRRKRGAQKGSGSPTHSLSQKS
  TRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGI
  QHLQKLSQELDEAIMAEESGDIVSLIHD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061886
• RefSeq Size: 1563
• RefSeq ORF: 714
• Synonyms: CATS; FAM64A; RCS1
• Locus ID: 54478
• UniProt ID: Q9BSJ6, A0A0S2Z5C7
• Cytogenetics: 17p13.2
• Summary: During mitosis, may play a role in the control of metaphase-to-anaphase transition.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome