ARMC1 (NM_018120) Human Mass Spec Standard

CAT#: PH300135

ARMC1 MS Standard C13 and N15-labeled recombinant protein (NP_060590)

Product Images

Coomassie blue staining of purified ARMC1 protein (Cat# TP300135). The protein was produced from HEK293T cells transfected with ARMC1 cDNA clone (Cat# RC200135) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200135
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200135 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSSTSTMSEEPDALSVVNQLRDLAADPLNRRAIVQDQGCLPGLILFMDHPNPPVVHSALLALRYLAECR
  ANREKMKGELGMMLSLQNVIQKTTTPGETKLLASEIYDILQSSNMADGDSFNEMNSRRRKAQFFLGTTNK
  RAKTVVLHIDGLDDTSRRNLCEEALLKIKGVISFTFQMAVQRCVVRIRSDLKAEALASAIASTKVMKAQQ
  VVKSESGEEMLVPFQDTPVEVEQNTELPDYLPEDESPTKEQDKAVSRVGSHPEGGASWLSTAANFLSRSF
  YW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060590
• RefSeq Size: 3051
• RefSeq ORF: 846
• Synonyms: Arcp
• Locus ID: 55156
• UniProt ID: Q9NVT9
• Cytogenetics: 8q13.1
• Summary: In association with mitochondrial contact site and cristae organizing system (MICOS) complex components and mitochondrial outer membrane sorting assembly machinery (SAM) complex components may regulate mitochondrial dynamics playing a role in determining mitochondrial length, distribution and motility.[UniProtKB/Swiss-Prot Function]