ADI1 (NM_018269) Human Mass Spec Standard

CAT#: PH300115

ADI1 MS Standard C13 and N15-labeled recombinant protein (NP_060739)

Product Images

Coomassie blue staining of purified ADI1 protein (Cat# TP300115). The protein was produced from HEK293T cells transfected with ADI1 cDNA clone (Cat# RC200115) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200115
• Predicted MW: 21.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200115 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITIC
  KDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEK
  NYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060739
• RefSeq Size: 1685
• RefSeq ORF: 537
• Synonyms: APL1; ARD; Fe-ARD; HMFT1638; MTCBP1; mtnD; Ni-ARD; SIPL
• Locus ID: 55256
• UniProt ID: Q9BV57
• Cytogenetics: 2p25.3
• Summary: This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending on its localization. Related pseudogenes have been defined on chromosomes 8 and 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]
• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways