AKR1A1 (NM_006066) Human Tagged ORF Clone

SKU
RC200302
AKR1A1 (Myc-DDK-tagged)-Human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol AKR1A1
Synonyms ALDR1; ALR; ARM; DD3; HEL-S-6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200302 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCTTCCTGTGTTCTACTGCACACTGGGCAGAAGATGCCTCTGATTGGTCTGGGTACCTGGAAGA
GTGAGCCTGGTCAGGTAAAAGCAGCTGTTAAGTATGCCCTTAGCGTAGGCTACCGCCACATTGATTGTGC
TGCTATCTACGGCAATGAGCCTGAGATTGGGGAGGCCCTGAAGGAGGACGTGGGACCAGGCAAGGCGGTG
CCTCGGGAGGAGCTGTTTGTGACATCCAAGCTGTGGAACACCAAGCACCACCCCGAGGATGTGGAGCCTG
CCCTCCGGAAGACTCTGGCTGACCTCCAGCTGGAGTATCTGGACCTGTACCTGATGCACTGGCCTTATGC
CTTTGAGCGGGGAGACAACCCCTTCCCCAAGAATGCTGATGGGACTATATGCTACGACTCCACCCACTAC
AAGGAGACTTGGAAGGCTCTGGAGGCACTGGTGGCTAAGGGGCTGGTGCAGGCGCTGGGCCTGTCCAACT
TCAACAGTCGGCAGATTGATGACATACTCAGTGTGGCCTCCGTGCGTCCAGCTGTCTTGCAGGTGGAATG
CCACCCATACTTGGCTCAAAATGAGCTAATTGCCCACTGCCAAGCACGTGGCCTGGAGGTAACTGCTTAT
AGCCCTTTGGGCTCCTCTGATCGTGCATGGCGTGATCCTGATGAGCCTGTCCTGCTGGAGGAACCAGTAG
TCCTGGCATTGGCTGAAAAGTATGGCCGATCTCCAGCTCAGATCTTGCTCAGGTGGCAGGTCCAGCGGAA
AGTGATCTGCATCCCCAAAAGTATCACTCCTTCTCGAATCCTTCAGAACATCAAGGTGTTTGACTTCACC
TTTAGCCCAGAAGAGATGAAGCAGCTAAATGCCCTGAACAAAAATTGGAGATATATTGTGCCTATGCTTA
CGGTGGATGGGAAGAGAGTCCCAAGGGATGCAGGGCATCCTCTGTACCCCTTTAATGACCCGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200302 protein sequence
Red=Cloning site Green=Tags(s)

MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEALKEDVGPGKAV
PREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTICYDSTHY
KETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAY
SPLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFT
FSPEEMKQLNALNKNWRYIVPMLTVDGKRVPRDAGHPLYPFNDPY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006066
ORF Size 975 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006066.4
RefSeq Size 1597 bp
RefSeq ORF 978 bp
Locus ID 10327
UniProt ID P14550
Cytogenetics 1p34.1
Domains aldo_ket_red
Protein Families Druggable Genome
Protein Pathways Glycerolipid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways
MW 36.6 kDa
Summary This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein. [provided by RefSeq, Jan 2011]
Write Your Own Review
You're reviewing:AKR1A1 (NM_006066) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC200302L1 Lenti ORF clone of Human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200302L2 Lenti ORF clone of Human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC200302L3 Lenti ORF clone of Human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC200302L4 Lenti ORF clone of Human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG200302 AKR1A1 (tGFP-tagged) - Human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC320185 AKR1A1 (untagged)-Human aldo-keto reductase family 1, member A1 (aldehyde reductase) (AKR1A1), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.